PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00088.1.g02400.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 328aa    MW: 34083 Da    PI: 9.6819
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00088.1.g02400.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof95.15.3e-304899657
                        zf-Dof  6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrk 57
                                   +cprC s +tkfCyynny+++qPr+fC+aCrryWt GG+lrnvP    +r+
  Zjn_sc00088.1.g02400.1.am.mk 48 EQCPRCASWDTKFCYYNNYNTAQPRHFCRACRRYWTLGGSLRNVPRPRPARR 99
                                  68*******************************************7665555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088425.30448102IPR003851Zinc finger, Dof-type
PfamPF027012.3E-264899IPR003851Zinc finger, Dof-type
ProDomPD0074787.0E-194991IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105086IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MEALLHHAPV PMPAPAPRQQ GAVIGASAAL QQVSAVTAQK PPAGAGREQC PRCASWDTKF  60
CYYNNYNTAQ PRHFCRACRR YWTLGGSLRN VPRPRPARRP TRAIAAALAD ASSSAGTAAG  120
AATTPSSSLC GPFAGSPVPA PAAAAVAAQN VGLLRSLLLG SVPLLEGRLG LGQAAASTGA  180
SDDLAQLGVS TGTPLWPVAG MEGDRATETT WKSGGVFPPT TAMWQELAAA TGAGMPQRLL  240
FVEHIPAEEE FLSTLRKRKL NAVKLKLPND PLSLLWVPVD QPPSISWSET APPCPFVGQL  300
VPVRCNSGRP TSTTGGNAVG CRAIQFLG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1254259LRKRKL
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY6616592e-50AY661659.1 Sorghum bicolor clone BAC 75D9, complete sequence.
GenBankHQ5400842e-50HQ540084.1 Sorghum bicolor clone SbDof1 Dof-type zinc finger protein gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008661525.13e-40PREDICTED: dof zinc finger protein DOF1.6-like
TrEMBLA0A096S6753e-40A0A096S675_MAIZE; Uncharacterized protein
STRINGGRMZM2G131897_P018e-40(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28810.22e-21Dof family protein